Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Mouse Adiponectin(Adipoq)

Recombinant Mouse Adiponectin(Adipoq)

Quick Overview:

Product Code: CSB-EP723362MO
Supplier: Cusabio

  • Details

    Recombinant proteins Full Length of Mature Protein Gene: Adipoq Uniprot: Q60994
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 100ug
    Concentration 0.1-2.0mg/ml
    Expression E.coli
    Construction 18-247aa EDDVTTTEELAPALVPPPKGTCAGWMAGIPGHPGHNGTPGRDGRDGTPGEKGEKGDAGLLGPKGETGDVGMTGAEGPRGFPGTPGRKGEPGEAAYVYRSAFSVGLETRVTVPNVPIRFTKIFYNQQNHYDGSTGKFYCNIPGLYYFSYHITVYMKDVKVSLFKKDKAVLFTYDQYQEKNVDQASGSVLLHLEVGDQVWLQVYGDGDHNGLYADNVNDSTFTGFLLYHDTN
    Source Mouse
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 28.9 kDa
    Purity Greater than 85% as determined by SDS-PAGE.
    Target/Antigen Adipoq
    Species Reactivity Mouse
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases 30KDA adipocyte complement-related protein;Adipocyte complement-related 30KDA protein ;ACRP30Adipocyte, C1q and collagen domain-containing protein;Adipocyte-specific protein AdipoQ
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images