Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Mouse C-X-C motif chemokine 11(Scyb11),partial

Recombinant Mouse C-X-C motif chemokine 11(Scyb11),partial

Quick Overview:

Product Code: CSB-RP092874m
Supplier: Cusabio

  • Details

    Recombinant proteins Partial Gene: Scyb11 Uniprot: Q9JHH5
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 100ug
    Concentration 0.1-2.0mg/ml
    Expression E.coli
    Construction 22-98aa FLMFKQGRCLCIGPGMKAVKMAEIEKASVIYPSNGCDKVEVIVTMKAHKRQRCLDPRSKQARLIMQAIEKKNFLRRQ
    Source Mouse
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 12.9 kDa
    Purity Greater than 90% as determined by SDS-PAGE.
    Target/Antigen Scyb11
    Species Reactivity Mouse
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases Interferon-inducible T-cell alpha chemoattractant ;I-TACSmall-inducible cytokine B11
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images