Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Mouse Cadherin-17(Cdh17),partial

Recombinant Mouse Cadherin-17(Cdh17),partial

Quick Overview:

Product Code: CSB-EP882608MO
Supplier: Cusabio

  • Details

    Recombinant proteins Partial Gene: Cdh17 Uniprot: Q9R100
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 100ug
    Concentration 0.1-2.0mg/ml
    Expression E.coli
    Construction 173-253aa INDVMYFQIDSKTGAISLTPEGSQELDPVKNPSYNLVVSVKDMGGQSENSFSDTTYVDISIRENIWKAPEPVEIRENSTDP
    Source Mouse
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 13.1 kDa
    Purity Greater than 85% as determined by SDS-PAGE.
    Target/Antigen Cdh17
    Species Reactivity Mouse
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases BILL-cadherin (Liver-intestine cadherin) (LI-cadherin) (P130)
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images