Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Mouse Complement C1q tumor necrosis factor-related protein 3(C1qtnf3)

Recombinant Mouse Complement C1q tumor necrosis factor-related protein 3(C1qtnf3)

Quick Overview:

Product Code: CSB-MP875360MO
Supplier: Cusabio

  • Details

    Recombinant proteins Full Length of Mature Protein Gene: C1qtnf3 Uniprot: Q9ES30
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 20ug
    Concentration 0.1-0.5mg/ml
    Expression Mammalian cell
    Construction 23-246aa QDEYMESPQAGGLPPDCSKCCHGDYGFRGYQGPPGPPGPPGIPGNHGNNGNNGATGHEGAKGEKGDKGDLGPRGERGQHGPKGEKGYPGVPPELQIAFMASLATHFSNQNSGIIFSSVETNIGNFFDVMTGRFGAPVSGVYFFTFSMMKHEDVEEVYVYLMHNGNTVFSMYSYETKGKSDTSSNHAVLKLAKGDEVWLRMGNGALHGDHQRFSTFAGFLLFETK
    Source Mouse
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 26.6 kDa
    Purity Greater than 85% as determined by SDS-PAGE.
    Target/Antigen C1qtnf3
    Species Reactivity Mouse
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases Collagenous repeat-containing sequence 26 kDa protein Short name:CORS26 Secretory protein CORS26 Ctrp3
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images