Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Mouse Complement component receptor 1-like protein(Cr1l),partial

Recombinant Mouse Complement component receptor 1-like protein(Cr1l),partial

Quick Overview:

Product Code: CSB-EP717575MO1
Supplier: Cusabio

  • Details

    Recombinant proteins Partial Gene: Cr1l Uniprot: Q64735
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 100ug
    Concentration 0.1-2.0mg/ml
    Expression E.coli
    Construction 41-405aa ELRGGLGKHGHTVHREPAVNRLCADSKRWSGLPVSAQRPFPMGHCPAPSQLPSAKPINLTDESMFPIGTYLLYECLPGYIKRQFSITCKQDSTWTSAEDKCIRKQCKTPSDPENGLVHVHTGIQFGSRINYTCNQGYRLIGSSSAVCVITDQSVDWDTEAPICEWIPCEIPPGIPNGDFFSSTREDFHYGMVVTYRCNTDARGKALFNLVGEPSLYCTSNDGEIGVWSGPPPQCIELNKCTPPPYV
    Source Mouse
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 44.5 kDa
    Purity Greater than 85% as determined by SDS-PAGE.
    Target/Antigen Cr1l
    Species Reactivity Mouse
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases Complement regulatory protein Crry Protein p65
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images