Serving Australia and NZ
1300 543 373
Loading...

Recombinant Mouse Disintegrin and metalloproteinase domain-containing protein 12(Adam12),partial

Recombinant Mouse Disintegrin and metalloproteinase domain-containing protein 12(Adam12),partial

Quick Overview:

Product Code: CSB-EP720263MO
Supplier: Cusabio

Details
Recombinant proteins Partial Gene: Adam12 Uniprot: Q61824
Additional Information
Product Name Recombinant Mouse Disintegrin and metalloproteinase domain-containing protein 12(Adam12),partial
Supplier name Cusabio
Concentration 0.1-2.0mg/ml
Construction 206-706aa ETLKMTKYVELVIVADNREFQRQGKDLEKVKQRLIEIANHVDKFYRPLNIRIVLVGVEVWNDIDKCSISQDPFTSLHEFLDWRKIKLLPRKSHDNAQLISGVYFQGTTIGMAPIMSMCTAEQSGGVVMDHSDSPLGAAVTLAHELGHNFGMNHDTLERGCSCRMAAEKGGCIMNPSTGFPFPMVFSSCSRKDLEASLEKGMGMCLFNLPEVKQAFGGRKCGNGYVEEGEECDCGEPEECTNRCCN
Source Mouse
Biological Activity Not Tested
Size 100ug
Endotoxin level Not Tested
Molecular Weight 61.4 kDa
Purity Greater than 85% as determined by SDS-PAGE.
Species Reactivity Mouse
Applications WB
Storage/Storage buffer Tris-based buffer, 50% glycerol
Form Liquid
Product Type Proteins
Expression E.coli
Purification Affinity purified
Aliases Meltrin-alpha () Mltna
Datasheet URL View Datasheet
Target/Antigen Adam12
Publications Publication List

Images