Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Mouse E3 ubiquitin-protein ligase TRIM21(Trim21)

Recombinant Mouse E3 ubiquitin-protein ligase TRIM21(Trim21)

Quick Overview:

Product Code: CSB-EP733816MO
Supplier: Cusabio

  • Details

    Recombinant proteins Full Length Gene: Trim21 Uniprot: Q62191
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 100ug
    Concentration 0.1-2.0mg/ml
    Expression E.coli
    Construction 1-470aa MSPSTTSKMSLEKMWEEVTCSICLDPMVEPMSIECGHCFCKECIFEVGKNGGSSCPECRQQFLLRNLRPNRHIANMVENLKQIAQNTKKSTQETHCMKHGEKLHLFCEEDGQALCWVCAQSGKHRDHTRVPIEEAAKVYQEKIHVVLEKLRKGKELAEKMEMDLTMQRTDWKRNIDTQKSRIHAEFALQNSLLAQEEQRQLQRLEKDQREYLRLLGKKEAELAEKNQALQELISELERRIRGSELEL
    Source Mouse
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 70.2 kDa
    Purity Greater than 90% as determined by SDS-PAGE.
    Target/Antigen Trim21
    Species Reactivity Mouse
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases 52KDA Ro protein52KDA ribonucleoprotein autoantigen Ro/SS-ARo(SS-A)Sjoegren syndrome type A antigen ;SS-ATripartite motif-containing protein 21
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images