Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Mouse EGF-containing fibulin-like extracellular matrix protein 1(Efemp1)

Recombinant Mouse EGF-containing fibulin-like extracellular matrix protein 1(Efemp1)

Quick Overview:

Product Code: CSB-MP007450MO
Supplier: Cusabio

  • Details

    Recombinant proteins Full Length of Mature Protein Gene: Efemp1 Uniprot: Q8BPB5
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 20ug
    Concentration 0.1-0.5mg/ml
    Expression Mammalian cell
    Construction 18-493aa QYTEETITYTQCTDGYEWDPIRQQCKDIDECDIVPDACKGGMKCVNHYGGYLCLPKTAQIIVNNEHPQQETPAAEASSGATTGTVAARSMATSGVVPGGGFMASATAVAGPEVQTGRNNFVIRRNPADPQRIPSNPSHRIQCAAGYEQSEHNVCQDIDECTSGTHNCRTDQVCINLRGSFTCQCLPGYQKRGEQCVDIDECTVPPYCHQRCVNTPGSFYCQCSPGFQLAANNYTCVDINECDASNQ
    Source Mouse
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 57.5 kDa
    Purity Greater than 90% as determined by SDS-PAGE.
    Target/Antigen Efemp1
    Species Reactivity Mouse
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases Fibulin-3
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images