Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Mouse Hyaluronan and proteoglycan link protein 1(Hapln1)

Recombinant Mouse Hyaluronan and proteoglycan link protein 1(Hapln1)

Quick Overview:

Product Code: CSB-MP010130MO
Supplier: Cusabio

  • Details

    Recombinant proteins Full Length of Mature Protein Gene: Hapln1 Uniprot: Q9QUP5
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 20ug
    Concentration 0.1-0.5mg/ml
    Expression Mammalian cell
    Construction 10-356aa ISVCWADHHLSDSYTPPDQDRVIHIQAENGPRLLVEAEQAKVFSHRGGNVTLPCKFYRDPTAFGSGIHKIRIKWTKLTSDYLREVDVFVSMGYHKKTYGGYQGRVFLKGGSDNDASLVITDLTLEDYGRYKCEVIEGLEDDTAVVALELQGVVFPYFPRLGRYNLNFHEARQACLDQDAVIASFDQLYDAWRGGLDWCNAGWLSDGSVQYPITKPREPCGGQNTVPGVRNYGFWDKDKSRYDVFCF
    Source Mouse
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 43.4 kDa
    Purity Greater than 90% as determined by SDS-PAGE.
    Target/Antigen Hapln1
    Species Reactivity Mouse
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases Cartilage-linking protein 1 Short name: Cartilage-link protein Proteoglycan link protein
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images