Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Mouse Interferon epsilon(Ifne)

Recombinant Mouse Interferon epsilon(Ifne)

Quick Overview:

Product Code: CSB-EP800374MO
Supplier: Cusabio

  • Details

    Recombinant proteins Full Length of Mature Protein Gene: Ifne Uniprot: Q80ZF2
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 100ug
    Concentration 0.1-2.0mg/ml
    Expression E.coli
    Construction 22-192aa LEPKRIPFQLWMNRESLQLLKPLPSSSVQQCLAHRKNFLLPQQPVSPHQYQEGQVLAVVHEILQQIFTLLQTHGTMGIWEENHIEKVLAALHRQLEYVESLGGLNAAQKSGGSSAQNLRLQIKAYFRRIHDYLENQRYSSCAWIIVQTEIHRCMFFVFRFTTWLSRQDPDP
    Source Mouse
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 36 kDa
    Purity Greater than 90% as determined by SDS-PAGE.
    Target/Antigen Ifne
    Species Reactivity Mouse
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases Interferon epsilon-1Interferon tau-1
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images