Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Mouse Interleukin-31 receptor subunit alpha(Il31ra),partial

Recombinant Mouse Interleukin-31 receptor subunit alpha(Il31ra),partial

Quick Overview:

Product Code: CSB-EP818362MO
Supplier: Cusabio

  • Details

    Recombinant proteins Extracellular Domain Gene: Il31ra Uniprot: Q8K5B1
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 100ug
    Concentration 0.1-2.0mg/ml
    Expression E.coli
    Construction 19-499aa VLPTKPENISCVFYFDRNLTCTWRPEKETNDTSYIVTLTYSYGKSNYSDNATEASYSFPRSCAMPPDICSVEVQAQNGDGKVKSDITYWHLISIAKTEPPIILSVNPICNRMFQIQWKPREKTRGFPLVCMLRFRTVNSSHWTEVNFENCKQVCNLTGLQAFTEYVLALRFRFNDSRYWSKWSKEETRVTMEEVPHVLDLWRILEPADMNGDRKVRLLWKKARGAPVLEKTFGYHIQYFAENSTNL
    Source Mouse
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 59.2 kDa
    Purity Greater than 85% as determined by SDS-PAGE.
    Target/Antigen Il31ra
    Species Reactivity Mouse
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases GLM-R (mGLM-R) (Gp130-like monocyte receptor) (Gp130-like receptor) (Novel cytokine receptor 10) (NR10) (ZcytoR17) (Glmr)
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images