Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Mouse Killer cell lectin-like receptor 3(Klra3),partial

Recombinant Mouse Killer cell lectin-like receptor 3(Klra3),partial

Quick Overview:

Product Code: CSB-EP720664MO
Supplier: Cusabio

  • Details

    Recombinant proteins Partial Gene: Klra3 Uniprot: Q64329
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 100ug
    Concentration 0.1-2.0mg/ml
    Expression E.coli
    Construction 70-266aa QYNQHKQEINETLNHHHNCSNMQRAFNLKEEMLTNKSIDCRPSNETLEYIKREQDRWDSKTKTVLDSSRDTGRGVKYWFCYSTKCYYFIMNKTTWSGCKANCQHYSVPILKIEDEDELKFLQRHVIPENYWIGLSYDKKKKEWAWIDNGPSKLDMKIRKMNFKSRGCVFLSKARIEDIDCNIPYYCICGKKLDKFPD
    Source Mouse
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 27.6 kDa
    Purity Greater than 85% as determined by SDS-PAGE.
    Target/Antigen Klra3
    Species Reactivity Mouse
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases 5E6 Lymphocyte antigen 49c Short name: Ly-49c Nk2.1 T-cell surface glycoprotein Ly-49C Ly-49c, Ly49C
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images