Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Mouse Low affinity immunoglobulin gamma Fc region receptor III(Fcgr3)

Recombinant Mouse Low affinity immunoglobulin gamma Fc region receptor III(Fcgr3)

Quick Overview:

Product Code: CSB-MP357412MO
Supplier: Cusabio

  • Details

    Recombinant proteins Full Length of Mature Protein Gene: Fcgr3 Uniprot: P08508
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 20ug
    Concentration 0.1-0.5mg/ml
    Expression Mammalian cell
    Construction 31-215aa ALPKAVVKLDPPWIQVLKEDMVTLMCEGTHNPGNSSTQWFHNGRSIRSQVQASYTFKATVNDSGEYRCQMEQTRLSDPVDLGVISDWLLLQTPQRVFLEGETITLRCHSWRNKLLNRISFFHNEKSVRYHHYKSNFSIPKANHSHSGDYYCKGSLGSTQHQSKPVTITVQDPATTSSISLVWYHT
    Source Mouse
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 25.2 kDa
    Purity Greater than 90% as determined by SDS-PAGE.
    Target/Antigen Fcgr3
    Species Reactivity Mouse
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases Fc-gamma RIII Short name: FcRIII CD_antigen: CD16
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images