Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Mouse Lymphocyte antigen 6E(Ly6e)

Recombinant Mouse Lymphocyte antigen 6E(Ly6e)

Quick Overview:

Product Code: CSB-EP717533MOb1
Supplier: Cusabio

  • Details

    Recombinant proteins Full Length of Mature Protein Gene: Ly6e Uniprot: Q64253
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 100ug
    Concentration 0.1-2.0mg/ml
    Expression E.coli
    Construction 21-102aa LMCFSCTDQKNNINCLWPVSCQEKDHYCITLSAAAGFGNVNLGYTLNKGCSPICPSENVNLNLGVASVNSYCCQSSFCNFSA
    Source Mouse
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 13.8 kDa
    Purity Greater than 90% as determined by SDS-PAGE.
    Target/Antigen Ly6e
    Species Reactivity Mouse
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases Stem cell antigen 2 Thymic shared antigen 1
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images