Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Mouse Methylcytosine dioxygenase TET2(Tet2),partial

Recombinant Mouse Methylcytosine dioxygenase TET2(Tet2),partial

Quick Overview:

Product Code: CSB-EP678395MO
Supplier: Cusabio

  • Details

    Recombinant proteins Partial Gene: Tet2 Uniprot: Q4JK59
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 100ug
    Concentration 0.1-2.0mg/ml
    Expression E.coli
    Construction 1810-1912aa RISLVLYRHKNLFLPKHCLALWEAKMAEKARKEEECGKNGSDHVSQKNHGKQEKREPTGPQEPSYLRFIQSLAENTGSVTTDSTVTTSPYAFTQVTGPYNTFV
    Source Mouse
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 27.0 kDa
    Purity Greater than 85% as determined by SDS-PAGE.
    Target/Antigen Tet2
    Species Reactivity Mouse
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases Protein Ayu17-449 (Kiaa1546)
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images