Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Mouse Muellerian-inhibiting factor(Amh) ,partial

Recombinant Mouse Muellerian-inhibiting factor(Amh) ,partial

Quick Overview:

Product Code: CSB-YP001666MO
Supplier: Cusabio

  • Details

    Recombinant proteins Partial Gene: Amh Uniprot: P27106
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 100ug
    Concentration 0.1-2.0mg/ml
    Expression Yeast
    Construction 450-552aa DKGQDGPCALRELSVDLRAERSVLIPETYQANNCQGACRWPQSDRNPRYGNHVVLLLKMQARGAALGRLPCCVPTAYAGKLLISLSEERISADHVPNMVATEC
    Source Mouse
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 13.3 kDa
    Purity Greater than 90% as determined by SDS-PAGE.
    Target/Antigen Amh
    Species Reactivity Mouse
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases Anti-Muellerian hormone ;AMH;Muellerian-inhibiting substance ;MIS
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images