Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Mouse Receptor-interacting serine/threonine-protein kinase 1(Ripk1)

Recombinant Mouse Receptor-interacting serine/threonine-protein kinase 1(Ripk1)

Quick Overview:

Product Code: CSB-EP720181MOa2
Supplier: Cusabio

  • Details

    Recombinant proteins Full Length Gene: Ripk1 Uniprot: Q60855
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 100ug
    Concentration 0.1-2.0mg/ml
    Expression E.coli
    Construction 1-656aa MQPDMSLDNIKMASSDLLEKTDLDSGGFGKVSLCYHRSHGFVILKKVYTGPNRAEYNEVLLEEGKMMHRLRHSRVVKLLGIIIEEGNYSLVMEYMEKGNLMHVLKTQIDVPLSLKGRIIVEAIEGMCYLHDKGVIHKDLKPENILVDRDFHIKIADLGVASFKTWSKLTKEKDNKQKEVSSTTKKNNGGTLYYMAPEHLNDINAKPTEKSDVYSFGIVLWAIFAKKEPYENVICTEQFVICIKSGNR
    Source Mouse
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 87.8 kDa
    Purity Greater than 85% as determined by SDS-PAGE.
    Target/Antigen Ripk1
    Species Reactivity Mouse
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases Cell death protein RIP (Receptor-interacting protein 1) (RIP-1) (Rinp) (Rip)
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images