Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Mouse Single Ig IL-1-related receptor(Sigirr),partial

Recombinant Mouse Single Ig IL-1-related receptor(Sigirr),partial

Quick Overview:

Product Code: CSB-EP888356MO
Supplier: Cusabio

  • Details

    Recombinant proteins Partial Gene: Sigirr Uniprot: Q9JLZ8
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 100ug
    Concentration 0.1-2.0mg/ml
    Expression E.coli
    Construction 1-117aa MAGVCDMAPNFLSPSEDQALGLALGREVALNCTAWVFSRPQCPQPSVQWLKDGLALGNGSHFSLHEDFWVSANFSEIVSSVLVLNLTNAEDYGTFTCSVWNVSSHSFTLWRAGPAGH
    Source Mouse
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 28.7 kDa
    Purity Greater than 90% as determined by SDS-PAGE.
    Target/Antigen Sigirr
    Species Reactivity Mouse
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases Single Ig IL-1R-related molecule Single immunoglobulin domain-containing IL1R-related protein Toll/interleukin-1 receptor 8 Short name: TIR8
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images