Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Mouse Tenascin(Tnc),partial

Recombinant Mouse Tenascin(Tnc),partial

Quick Overview:

Product Code: CSB-MP768917MO
Supplier: Cusabio

  • Details

    Recombinant proteins Partial Gene: Tnc Uniprot: Q80YX1
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 20ug
    Concentration 0.1-0.5mg/ml
    Expression Mammalian cell
    Construction 1884-2099aa GLLYPFPRDCSQAMLNGDTTSGLYTIYINGDKTQALEVYCDMTSDGGGWIVFLRRKNGREDFYRNWKAYAAGFGDRREEFWLGLDNLSKITAQGQYELRVDLQDHGESAYAVYDRFSVGDAKSRYKLKVEGYSGTAGDSMNYHNGRSFSTYDKDTDSAITNCALSYKGAFWYKNCHRVNLMGRYGDNNHSQGVNWFHWKGHEYSIQFAEMKLRPSN
    Source Mouse
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 28.8 kDa
    Purity Greater than 85% as determined by SDS-PAGE.
    Target/Antigen Tnc
    Species Reactivity Mouse
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases Hexabrachion Tenascin-C Short name: TN-C Hxb
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images