Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Mouse Triggering receptor expressed on myeloid cells 2(Trem2),partial

Recombinant Mouse Triggering receptor expressed on myeloid cells 2(Trem2),partial

Quick Overview:

Product Code: CSB-MP024405MO
Supplier: Cusabio

  • Details

    Recombinant proteins Extracellular Domain Gene: Trem2 Uniprot: Q99NH8
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 20ug
    Concentration 0.1-0.5mg/ml
    Expression Mammalian cell
    Construction 19-171aa LNTTVLQGMAGQSLRVSCTYDALKHWGRRKAWCRQLGEEGPCQRVVSTHGVWLLAFLKKRNGSTVIADDTLAGTVTITLKNLQAGDAGLYQCQSLRGREAEVLQKVLVEVLEDPLDDQDAGDLWVPEESSSFEGAQVEHSTSRNQETSFPPTS
    Source Mouse
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 20.8 kDa
    Purity Greater than 90% as determined by SDS-PAGE.
    Target/Antigen Trem2
    Species Reactivity Mouse
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases Triggering receptor expressed on monocytes 2
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images