Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Mouse Uroplakin-3a(Upk3a),partial

Recombinant Mouse Uroplakin-3a(Upk3a),partial

Quick Overview:

Product Code: CSB-EP862403MO
Supplier: Cusabio

  • Details

    Recombinant proteins Partial Gene: Upk3a Uniprot: Q9JKX8
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 100ug
    Concentration 0.1-2.0mg/ml
    Expression E.coli
    Construction 19-207aa VNLQPQLASVTFATNNPTLTTVALEKPLCMFDSSEPLSGSYEVYLYAMVDSAMSRNVSVQDSAGVPLSTTFRQTQGGRSGPYKAAAFDLTPCGDLPSLDAVGDVTQASEILNAYLVRVGNNGTCFWDPNFQGLCNPPLTAATEYRFKYVLVNMSTGLVQDQTLWSDPIWTNRPIPYSAIDTWPGRRSGG
    Source Mouse
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 25.5 kDa
    Purity Greater than 85% as determined by SDS-PAGE.
    Target/Antigen Upk3a
    Species Reactivity Mouse
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases Uroplakin III Short name: UPIII Upk3
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images