Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Neisseria meningitidis serogroup B Transferrin-binding protein 1(tbp1),partial

Recombinant Neisseria meningitidis serogroup B Transferrin-binding protein 1(tbp1),partial

Quick Overview:

Product Code: CSB-EP881449NGG
Supplier: Cusabio

  • Details

    Recombinant proteins Partial Gene: tbp1 Uniprot: Q9K0U9
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 100ug
    Concentration 0.1-2.0mg/ml
    Expression E.coli
    Construction 22-300aa AYAENVQAGQAQEKQLDTIQVKAKKQKTRRDNEVTGLGKLVKSSDTLSKEQVLNIRDLTRYDPGIAVVEQGRGASSGYSIRGMDKNRVSLTVDGVSQIQSYTAQAALGGTRTAGSSGAINEIEYENVKAVEISKGSNSVEQGSGALAGSVAFQTKTADDVIGEGRQWGIQSKTAYSGKNRGLTQSIALAGRIGGAEALLIHTGRRAGEIRAHEDAGRGVQSFNRLVPVEDSSNYAYFIVKEECKNG
    Source Neisseria meningitidis serogroup B (strain MC58)
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 37.0 kDa
    Purity Greater than 85% as determined by SDS-PAGE.
    Target/Antigen tbp1
    Species Reactivity Other
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images