Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Newcastle disease virus Nucleoprotein(N)

Recombinant Newcastle disease virus Nucleoprotein(N)

Quick Overview:

Product Code: CSB-EP741755NCT
Supplier: Cusabio

  • Details

    Recombinant proteins Full Length Gene: N Uniprot: Q77K03
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 100ug
    Concentration 0.1-2.0mg/ml
    Expression E.coli
    Construction 1-489aa MSSVFDEYEQLLAAQTRPNGAHGGGEKGSTLKVDVPVFTLNSDDPEDRWSFVVFCLRIAVSEDANKPLRQGALISLLCSHSQVMRNHVALAGKQNEATLAVLEIDGFANGTPQFNNRSGVSEERAQRFAMIAGSLPRACSNGTPFVTAGAEDDAPEDITDTLERILSIQAQVWVTVAKAMTAYETADESETRRINKYMQQGRVQKKYILYPVCRSTIQLTIRQSLAVRIFLVSELKRGRNTAGGTST
    Source Newcastle disease virus (strain Chicken/United States/B1/48) (NDV)
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 57 kDa
    Purity Greater than 90% as determined by SDS-PAGE.
    Target/Antigen N
    Species Reactivity Other
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases Nucleocapsid protein Short name: NP Short name: Protein N
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images