Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Pig Calcium-activated chloride channel regulator 1(CLCA1),partial

Recombinant Pig Calcium-activated chloride channel regulator 1(CLCA1),partial

Quick Overview:

Product Code: CSB-EP886948PI
Supplier: Cusabio

  • Details

    Recombinant proteins Partial Gene: CLCA1 Uniprot: Q9TUB5
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 100ug
    Concentration 0.1-2.0mg/ml
    Expression E.coli
    Construction 46-199aa DERLIQNIKDMVTKASPYLFEATEKRFYFKNVAILIPASWKAKPEYVKPKLETYKNADVVVTEPNPPENDGPYTEQMGNCGEKGEKIYFTPDFVAGKKVLQYGPQGRVFVHEWAHLRWGVFNEYNNEQKFYLSNKKEQPVICSAAIRGTNVLPQ
    Source Pig
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 22.8 kDa
    Purity Greater than 85% as determined by SDS-PAGE.
    Target/Antigen CLCA1
    Species Reactivity Swine
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases Calcium-activated chloride channel family member 1 pCLCA1 AECC
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images