Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Pig Rhodopsin(RHO),partial

Recombinant Pig Rhodopsin(RHO),partial

Quick Overview:

Product Code: CSB-MP019681PI1
Supplier: Cusabio

  • Details

    Recombinant proteins Partial Gene: RHO Uniprot: O18766
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 20ug
    Concentration 0.1-0.5mg/ml
    Expression Mammalian cell
    Construction 1-36aa MNGTEGPNFYVPFSNKTGVVRSPFEYPQYYLAEPWQ
    Source Pig
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 34.2 kDa
    Purity Greater than 85% as determined by SDS-PAGE.
    Target/Antigen RHO
    Species Reactivity Swine
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases RHO1
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images