Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Pyrococcus furiosus Putative L-asparaginase(PF0142),partial

Recombinant Pyrococcus furiosus Putative L-asparaginase(PF0142),partial

Quick Overview:

Product Code: CSB-EP823641FHW
Supplier: Cusabio

  • Details

    Recombinant proteins Partial Gene: PF0142 Uniprot: Q8U4E6
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 100ug
    Concentration 0.1-2.0mg/ml
    Expression E.coli
    Construction 1-175aa MVAIIVHGGAGTIRKEERIPKIIEGVREAVLTGWRELKKGSALDAVEEAVKVLEDNPLFNAGTGSVLTLDGKVEMDAAIMRGKTLDAGAVAGIWGVKNPISVARKVMEKTDHVLLIGEGAVKFARLMGFPEYDPTTEERRKQWEELRKKLLETGEIRHWKKLSELIKEYPEVLRS
    Source Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 35.5 kDa
    Purity Greater than 90% as determined by SDS-PAGE.
    Target/Antigen PF0142
    Species Reactivity Other
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases L-asparagine amidohydrolase Cleaved into the following 2 chains: Putative L-asparaginase subunit alpha Putative L-asparaginase subunit beta
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images