Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Rabbit Histidine triad nucleotide-binding protein 1(HINT1)

Recombinant Rabbit Histidine triad nucleotide-binding protein 1(HINT1)

Quick Overview:

Product Code: CSB-MP301425RB
Supplier: Cusabio

  • Details

    Recombinant proteins Full Length of Mature Protein Gene: HINT1 Uniprot: P80912
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 20ug
    Concentration 0.1-0.5mg/ml
    Expression Mammalian cell
    Construction 2-126aa ADEIAKAQVARPGGDTIFGKIIRKEIPAKIIFEDDQCLAFHDISPQAPTHFLVIPKKHISQISAAEDADESLLGHLMIVGKKCAADLGLKKGYRMVVNEGSDGGQSVYHVHLHVLGGRQMNWPPG
    Source Rabbit
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 17.6 kDa
    Purity Greater than 90% as determined by SDS-PAGE.
    Target/Antigen HINT1
    Species Reactivity Rabbit
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases Adenosine 5'-monophosphoramidase P13.7
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images