Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Rabbit Tissue factor pathway inhibitor(TFPI)

Recombinant Rabbit Tissue factor pathway inhibitor(TFPI)

Quick Overview:

Product Code: CSB-MP023437RB
Supplier: Cusabio

  • Details

    Recombinant proteins Full Length of Mature Protein Gene: TFPI Uniprot: P19761
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 20ug
    Concentration 0.1-0.5mg/ml
    Expression Mammalian cell
    Construction 25-300aa AAEEDEEFTNITDIKPPLQKPTHSFCAMKVDDGPCRAYIKRFFFNILTHQCEEFIYGGCEGNENRFESLEECKEKCARDYPKMTTKLTFQKGKPDFCFLEEDPGICRGYITRYFYNNQSKQCERFKYGGCLGNLNNFESLEECKNTCENPTSDFQVDDHRTQLNTVNNTLINQPTKAPRRWAFHGPSWCLPPADRGLCQANEIRFFYNAIIGKCRPFKYSGCGGNENNFTSKKACITACKKGFIPK
    Source Rabbit
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 35.3 kDa
    Purity Greater than 85% as determined by SDS-PAGE.
    Target/Antigen TFPI
    Species Reactivity Rabbit
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases Extrinsic pathway inhibitor (EPI) (Lipoprotein-associated coagulation inhibitor) (LACI)
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images