Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Rat Allograft inflammatory factor 1(Aif1)

Recombinant Rat Allograft inflammatory factor 1(Aif1)

Quick Overview:

Product Code: CSB-YP001490RA
Supplier: Cusabio

  • Details

    Recombinant proteins Full Length of Mature Protein Gene: Aif1 Uniprot: P55009
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 100ug
    Concentration 0.1-2.0mg/ml
    Expression Yeast
    Construction 2-147aa SQSKDLQGGKAFGLLKAQQEERLDGINKHFLDDPKYSSDEDLQSKLEAFKTKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIREVSSGSEETFSYSDFLRMMLGKRSAILRMILMYEEKNKEHQKPTGPPAKKAISELP
    Source Rat
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 18.7 kDa
    Purity Greater than 90% as determined by SDS-PAGE.
    Target/Antigen Aif1
    Species Reactivity Rat
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases Ionized calcium-binding adapter molecule 1 MRF-1 Microglia response factor
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images