Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Rat COMM domain-containing protein 5(Commd5)

Recombinant Rat COMM domain-containing protein 5(Commd5)

Quick Overview:

Product Code: CSB-EP880645RA
Supplier: Cusabio

  • Details

    Recombinant proteins Full Length of Mature Protein Gene: Commd5 Uniprot: Q9ERR2
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 100ug
    Concentration 0.1-2.0mg/ml
    Expression E.coli
    Construction 2-224aa SALGAAAPYLHHPADSHSGRVSFLGSQPSPEVTAVAQLLKDLDRSTFRKLLKLVVGALHGKDCREAVEQLGASANLSEERLAVLLAGTHTLLQQALRLPPASLKPDAFQEELQELGIPQDLIGDLASLAFGSQRPLLDSVAQQQGSSLPHVSYFRWRVDVAISTSAQSRSLQPSVLMQLKLTDGSAHRFEVPIAKFQELRYSVALVLKEMAELEKKCERKLQD
    Source Rat
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 31.8 kDa
    Purity Greater than 85% as determined by SDS-PAGE.
    Target/Antigen Commd5
    Species Reactivity Rat
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases Hypertension-related calcium-regulated gene protein (HCaRG)
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images