Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Rat Fatty acid-binding protein, heart(Fabp3)

Recombinant Rat Fatty acid-binding protein, heart(Fabp3)

Quick Overview:

Product Code: CSB-MP007943RA
Supplier: Cusabio

  • Details

    Recombinant proteins Full Length of Mature Protein Gene: FABP3 Uniprot: P07483
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 20ug
    Concentration 0.1-0.5mg/ml
    Expression Mammalian cell
    Construction 2-133aa ADAFVGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDTITIKTHSTFKNTEISFQLGVEFDEVTADDRKVKSVVTLDGGKLVHVQKWDGQETTLTRELSDGKLILTLTHGNVVSTRTYEKEA
    Source Rat
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 18.6 kDa
    Purity Greater than 90% as determined by SDS-PAGE.
    Target/Antigen FABP3
    Species Reactivity Rat
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases Fatty acid-binding protein 3 Heart-type fatty acid-binding protein Short name: H-FABP
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images