Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Rat Nitric oxide synthase, endothelial(Nos3),partial

Recombinant Rat Nitric oxide synthase, endothelial(Nos3),partial

Quick Overview:

Product Code: CSB-RP165794r(A3)
Supplier: Cusabio

  • Details

    Recombinant proteins Partial Gene: Nos3 Uniprot: Q62600
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 100ug
    Concentration 0.1-2.0mg/ml
    Expression E.coli
    Construction 519-690aa ATILYGSETGRAQSYAQQLGRLFRKAFDPRVLCMDEYDVVSLEHEALVLVVTSTFGNGDPPENGESFAAALMEMSGPYNSSPRPEQHKSYKIRFNSVSCSDPLVSSWRRKRKESSNTDSAGALGTLRFCVFGLGSRAYPHFCAFARAVDTRLEELGGERLLQLGQGDELCGQ
    Source Rat
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 22.9 kDa
    Purity Greater than 90% as determined by SDS-PAGE.
    Target/Antigen Nos3
    Species Reactivity Rat
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases Constitutive NOS ;cNOSEC-NOSEndothelial NOS ;eNOSNOS type III ;NOSIII
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images