Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Rat Retinoblastoma-associated protein(Rb1),partial

Recombinant Rat Retinoblastoma-associated protein(Rb1),partial

Quick Overview:

Product Code: CSB-RP155294r(A3)
Supplier: Cusabio

  • Details

    Recombinant proteins Partial Gene: Rb1 Uniprot: P33568
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 100ug
    Concentration 0.1-2.0mg/ml
    Expression E.coli
    Construction 721-919aa KDLPHAAQETFKRVLIREEEFDSIIVFYNSVFMQRLKTNILQYASTRPPTLSPIPHIPRSPYKFSSSPLRIPGGNIYISPLKSPYKISEGLPTPTKMTPRSRILVSIGESFGTSEKFQKINQMVCNSDRVLKRSAEGGNPPKPLKKLRFDIEGSDEADGSKHLPAESKFQQKLAEMTSTRTRMQKQKLNDSMEISNKEE
    Source Rat
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 26.6 kDa
    Purity Greater than 90% as determined by SDS-PAGE.
    Target/Antigen Rb1
    Species Reactivity Rat
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases pRb ;Rbpp105
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images