Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Rat Tyrosine-protein kinase Mer(Mertk),partial

Recombinant Rat Tyrosine-protein kinase Mer(Mertk),partial

Quick Overview:

Product Code: CSB-MP013706RA
Supplier: Cusabio

  • Details

    Recombinant proteins Partial Gene: Mertk Uniprot: P57097
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 20ug
    Concentration 0.1-0.5mg/ml
    Expression Mammalian cell
    Construction 19-497aa GGTAEKEEEIKPDQPFSGPLPGSLPADHRPFFAPHSSGDQLSPSQTGRSHPAHTATPQMTSAASNLLPPVAFKNTIGRIVLSEHKSVKFNCSINIPNVYQETAGISWWKDGKELLGAHHSITQFYPDEEGVSIIALFSITSVQRSDNGSYICKMKVNDREVVSDPIYVEVQGLPYFTKQPESVNVTRNTAFNLTCQAVGPPEPVNIFWVQNSSRVNENPERSPSVLTVAGLTETAVFSCEAHNDKG
    Source Rat
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 55.5 kDa
    Purity Greater than 90% as determined by SDS-PAGE.
    Target/Antigen Mertk
    Species Reactivity Rat
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases Proto-oncogene c-Mer (Receptor tyrosine kinase MerTK)
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images