Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Rat Vasopressin V1a receptor(Avpr1a),partial

Recombinant Rat Vasopressin V1a receptor(Avpr1a),partial

Quick Overview:

Product Code: CSB-RP156244r
Supplier: Cusabio

  • Details

    Recombinant proteins Partial Gene: Avpr1a Uniprot: P30560
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 100ug
    Concentration 0.1-2.0mg/ml
    Expression E.coli
    Construction 7-52aa SQDRSVGNSSPWWPLTTEGSNGSQEAARLGEGDSPLGDVRNEELAK
    Source Rat
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 31.9 kDa
    Purity Greater than 90% as determined by SDS-PAGE.
    Target/Antigen Avpr1a
    Species Reactivity Rat
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases AVPR V1aAntidiuretic hormone receptor 1aVascular/hepatic-type arginine vasopressin receptor
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images