Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Rickettsia conorii Outer membrane protein A(ompA),partial

Recombinant Rickettsia conorii Outer membrane protein A(ompA),partial

Quick Overview:

Product Code: CSB-EP706579RMS
Supplier: Cusabio

  • Details

    Recombinant proteins Partial Gene: ompA Uniprot: Q52657
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 100ug
    Concentration 0.1-2.0mg/ml
    Expression E.coli
    Construction 1734-2021aa DMDAKFGAWISPFVGNATQKMCNSISGYKSDTTGGTIGFDGFVSDDLVLGLAYTRADTDIKLKNNKTGDKNKVESNIYSLYGLYSVPYENLFVEAIASYSDNKIRSKSRRVIATTLETVGYQTANGKYKSESYTGQLMAGYTYMMSENINLTPLAGLRYSTIKDKSYKETGTTYQNLTVKGKNYNTFDGLLGAKVSSNINVNEIVLTPELYAMVDYAFKNKVSAIDARLQGMTAPLPTNSFKQ
    Source Rickettsia conorii (strain ATCC VR-613 / Malish 7)
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 51.8 kDa
    Purity Greater than 85% as determined by SDS-PAGE.
    Target/Antigen ompA
    Species Reactivity Other
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases 190KDA antigen Cell surface antigen rOmp A
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images