Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Saccharomyces cerevisiae Diphosphoinositol polyphosphate phosphohydrolase DDP1(DDP1)

Recombinant Saccharomyces cerevisiae Diphosphoinositol polyphosphate phosphohydrolase DDP1(DDP1)

Quick Overview:

Product Code: CSB-EP860334SVG
Supplier: Cusabio

  • Details

    Recombinant proteins Full Length of Mature Protein Gene: DDP1 Uniprot: Q99321
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 100ug
    Concentration 0.1-2.0mg/ml
    Expression E.coli
    Construction 2-188aa GKTADNHGPVRSETAREGRENQVYSPVTGARLVAGCICLTPDKKQVLMITSSAHKKRWIVPKGGVEKDEPNYETTAQRETWEEAGCIGKIVANLGTVEDMRPPKDWNKDIKQFENSRKDSEVAKHPPRTEFHFYELEIENLLDKFPECHKRHRKLYSYTEAKQNLIDAKRPELLEALNRSAIIKDDK
    Source Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 37.4 kDa
    Purity Greater than 90% as determined by SDS-PAGE.
    Target/Antigen DDP1
    Species Reactivity Other
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases Diadenosine 5',5'''-P1,P6-hexaphosphate hydrolase Short name: Ap6A hydrolase Diadenosine and diphosphoinositol polyphosphate phosphohydrolase 1 Diadenosine hexaphosphate hydrolase (AMP-forming)
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images