Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Salmonella enterica OmpA family protein(A673_03341),partial

Recombinant Salmonella enterica OmpA family protein(A673_03341),partial

Quick Overview:

Product Code: CSB-MP028238SBG
Supplier: Cusabio

  • Details

    Recombinant proteins Partial Gene: A673_03341 Uniprot: S4JJH7
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 20ug
    Concentration 0.1-0.5mg/ml
    Expression Mammalian cell
    Construction 82-220aa DVQEAKLRDKMRGTGVSVTRSGDNIILNMPNNVTFDSSSATLKPAGANTLTGVAMVLKEYPKTAVNVVGYTDSTGSHDLNMRLSQQRADSVASSLITQGVDASRIRTSGMGPANPIASNSTAEGKAQNRRVEITLSPLQ
    Source Salmonella enterica subsp. enterica serovar Enteritidis str. 2009K0958
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 18.6 kDa
    Purity Greater than 90% as determined by SDS-PAGE.
    Target/Antigen A673_03341
    Species Reactivity Other
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images