Serving Australia and NZ
1300 543 373
Loading...

Recombinant Salmonella typhi Universal stress protein A(uspA)

Recombinant Salmonella typhi Universal stress protein A(uspA)

Quick Overview:

Product Code: CSB-MP820596SWW
Supplier: Cusabio

Details
Recombinant proteins Full Length of Mature Protein Gene: uspA Uniprot: Q8Z268
Additional Information
Product Name Recombinant Salmonella typhi Universal stress protein A(uspA)
Supplier name Cusabio
Concentration 0.1-0.5mg/ml
Construction 2-144aa AYKHILIAVDLSPESKVLVEKAVSMARPYNAKISLIHVDVNYSDLYTGLIDVNLGDMQKRISKETHHALTELSTNAGYPITETLSGSGDLGQVLVDAIKKYDMDLVVCGHHQDFWSKLMSSARQLINTVHVDMLIVPLRDEEE
Source Salmonella typhi
Biological Activity Not Tested
Size 20ug
Endotoxin level Not Tested
Molecular Weight 19.9 kDa
Purity Greater than 90% as determined by SDS-PAGE.
Species Reactivity Other
Applications WB
Storage/Storage buffer Tris-based buffer, 50% glycerol
Form Liquid
Product Type Proteins
Expression Mammalian cell
Purification Affinity purified
Datasheet URL View Datasheet
Target/Antigen uspA
Publications Publication List

Images