Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Staphylococcus aureus Clumping factor A(clfA) ,partial

Recombinant Staphylococcus aureus Clumping factor A(clfA) ,partial

Quick Overview:

Product Code: CSB-EP692021FLB
Supplier: Cusabio

  • Details

    Recombinant proteins Partial Gene: clfA Uniprot: Q5HHM8
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 100ug
    Concentration 0.1-2.0mg/ml
    Expression E.coli
    Construction 229-559aa GTDITNQLTNVTVGIDSGTTVYPHQAGYVKLNYGFSVPNSAVKGDTFKITVPKELNLNGVTSTAKVPPIMAGDQVLANGVIDSDGNVIYTFTDYVNTKDDVKATLTMPAYIDPENVKKTGNVTLATGIGSTTANKTVLVDYEKYGKFYNLSIKGTIDQIDKTNNTYRQTIYVNPSGDNVIAPVLTGNLKPNTDSNALIDQQNTSIKVYKVDNAADLSESYFVNPENFEDVTNSVNITFPNPNQYK
    Source Staphylococcus aureus (strain COL)
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 52 kDa
    Purity Greater than 90% as determined by SDS-PAGE.
    Target/Antigen clfA
    Species Reactivity Other
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases Fibrinogen receptor A Fibrinogen-binding protein A
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images