Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Streptomyces sp. Cholesterol oxidase(choA)

Recombinant Streptomyces sp. Cholesterol oxidase(choA)

Quick Overview:

Product Code: CSB-EP704121SPX
Supplier: Cusabio

  • Details

    Recombinant proteins Full Length of Mature Protein Gene: choA Uniprot: P12676
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 100ug
    Concentration 0.1-2.0mg/ml
    Expression E.coli
    Construction 43-546aa DNGGYVPAVVIGTGYGAAVSALRLGEAGVQTLMLEMGQLWNQPGPDGNIFCGMLNPDKRSSWFKNRTEAPLGSFLWLDVVNRNIDPYAGVLDRVNYDQMSVYVGRGVGGGSLVNGGMAVEPKRSYFEEILPRVDSSEMYDRYFPRANSMLRVNHIDTKWFEDTEWYKFARVSREQAGKAGLGTVFVPNVYDFGYMQREAAGEVPKSALATEVIYGNNHGKQSLDKTYLAAALGTGKVTIQTLHQVK
    Source Streptomyces sp. (strain SA-COO)
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 81.9 kDa
    Purity Greater than 90% as determined by SDS-PAGE.
    Target/Antigen choA
    Species Reactivity Other
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases Cholesterol isomerase (EC:5.3.3.1)
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images