Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Streptomyces viridochromogenes Phosphinothricin N-acetyltransferase(pat)

Recombinant Streptomyces viridochromogenes Phosphinothricin N-acetyltransferase(pat)

Quick Overview:

Product Code: CSB-EP701139FOQ
Supplier: Cusabio

  • Details

    Recombinant proteins Full Length Gene: pat Uniprot: Q57146
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 100ug
    Concentration 0.1-2.0mg/ml
    Expression E.coli
    Construction 1-183aa MSPERRPVEIRPATAADMAAVCDIVNHYIETSTVNFRTEPQTPQEWIDDLERLQDRYPWLVAEVEGVVAGIAYAGPWKARNAYDWTVESTVYVSHRHQRLGLGSTLYTHLLKSMEAQGFKSVVAVIGLPNDPSVRLHEALGYTARGTLRAAGYKHGGWHDVGFWQRDFELPAPPRPVRPVTQI
    Source Streptomyces viridochromogenes
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 36.6 kDa
    Purity Greater than 90% as determined by SDS-PAGE.
    Target/Antigen pat
    Species Reactivity Other
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases Phosphinothricin-resistance protein
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images