Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Sudan ebolavirus Envelope glycoprotein (GP) ,partial

Recombinant Sudan ebolavirus Envelope glycoprotein (GP) ,partial

Quick Overview:

Product Code: CSB-MP742487SRE
Supplier: Cusabio

  • Details

    Recombinant proteins Partial Gene: GP Uniprot: Q7T9D9
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 20ug
    Concentration 0.1-0.5mg/ml
    Expression Mammalian cell
    Construction 502-637aa QTNTKATGKCNPNLHYWTAQEQHNAAGIAWIPYFGPGAEGIYTEGLMHNQNALVCGLRQLANETTQALQLFLRATTELRTYTILNRKAIDFLLRRWGGTCRILGPDCCIEPHDWTKNITDKINQIIHDFIDNPLPN
    Source Sudan ebolavirus (strain Human/Uganda/Gulu/2000) (SEBOV) (Sudan Ebola virus)
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 19.4 kDa
    Purity Greater than 90% as determined by SDS-PAGE.
    Target/Antigen GP
    Species Reactivity Other
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases GP1,2 Short name: GP
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images