Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Trypanosoma cruzi Kinetoplastid membrane protein 11 (KMP-11)

Recombinant Trypanosoma cruzi Kinetoplastid membrane protein 11 (KMP-11)

Quick Overview:

Product Code: CSB-EP880045TQY
Supplier: Cusabio

  • Details

    Recombinant proteins Full Length Gene: KMP-11 Uniprot: Q9U6Z1
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 100ug
    Concentration 0.1-2.0mg/ml
    Expression E.coli
    Construction 1-92aa MATTLEEFSAKLDRLDAEFAKKMEEQNKKFFADKPDESTLSPEMKEHYEKFEKMIQEHTDKFNKKMHEHSEHFKAKFAELLEQQKNAQFPGK
    Source Trypanosoma cruzi
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 18.0 kDa
    Purity Greater than 85% as determined by SDS-PAGE.
    Target/Antigen KMP-11
    Species Reactivity Other
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases KMP11
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images