Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Vibrio vulnificus Fe/S biogenesis protein NfuA(nfuA)

Recombinant Vibrio vulnificus Fe/S biogenesis protein NfuA(nfuA)

Quick Overview:

Product Code: CSB-MP813457VFI
Supplier: Cusabio

  • Details

    Recombinant proteins Full Length Gene: nfuA Uniprot: Q8DDU2
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 20ug
    Concentration 0.1-0.5mg/ml
    Expression Mammalian cell
    Construction 1-194aa MSNITITEAAQTHFANLLGQQPDGTNIRVFVVNPGTQNAECGVSYCPPEAVEATDTEIPYQSFSAYVDELSLPFLEDAEIDYVTDKMGSQLTLKAPNAKMRKVADDAPLLERVEYAIQTQVNPQLAGHGGHVKLMEITDAGVAIVAFGGGCNGCSMVDVTLKEGIEKELLQQFSGELTAVRDATEHDRGDHSYY
    Source Vibrio vulnificus (strain CMCP6)
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 47 kDa
    Purity Greater than 90% as determined by SDS-PAGE.
    Target/Antigen nfuA
    Species Reactivity Other
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images